SUMO-tag Antibody (4G11E9), mAb, Mouse - 40μg – Witec AG

Art No | A01693-40
140.00 CHF
140.00 CHF
Brochure

Size: 40 µg

Description

SUMO-tag Antibody (4G11E9), mAb, Mouse specifically reacts with fusion proteins containing SUMO epitope tags.

Applications

Working concentrations for specific applications should be determined by the investigators. The appropriate concentrations may be affected by secondary antibody affinity, antigen concentration, the sensitivity of the method of detection, temperature, the length of the incubations, and other factors. The suitability of this antibody for applications other than those listed below has not been determined. The following concentration ranges are recommended starting points for this product.

  • ELISA - recommended usage: 0.05-0.2 µg/ml
  • Western Blot - recommended usage: 0.5-1 µg/ml

Target background

SUMO tags are emerging as a viable alternative for increasing both the expression and solubility of otherwise hard-to-express proteins. The SUMO tag can be cleanly excised using SUMO protease, which recognizes the conformation of SUMO protein rather than a specific sequence within SUMO. The SUMO system can be used effectively in both prokaryotic and eukaryotic systems.

GenScript SUMO-tag Antibody (4G11E9), mAb, Mouse is suitable for detecting fusion proteins that contain a SUMO-tag. The SUMO-tag Antibody (4G11E9), mAb, Mouse is produced from the hybridoma resulting from fusion of Sp2/0 myeloma and lymphocytes obtained from mouse immunized with recombinant yeast SUMO protein.

 

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

A01693-40-SUMO-tag-Antibody-1

Western blot analysis of SUMO-tagged fusion protein using SUMO-tag Antibody (4G11E9), mAb, Mouse (GenScript, A01693, 1 µg/ml).

The signal was developed with IRDyeTM 800 Conjugated Goat Anti-Mouse IgG.

Predicted Size: 62 kD

Observed Size: 62 kD

A01693-40-SUMO-tag-Antibody-2

Western Blot of SUMO protein with SUMO-tag Antibody (4G11E9), mAb, Mouse (GenScript, A01693)

Lane 1: 20 ng SUMO protein
Lane 2: 10 ng SUMO protein
Lane 3: 5 ng SUMO protein

Primary Antibody:
SUMO-tag Antibody (4G11E9), mAb, Mouse (GenScript, A01693), 1 µg/ml

Secondary Antibody:
Peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcγ Fragment Specific, 0.2 μg/ml

Predicted Size: 11 kD
Observed Size: 18 kD

Supplier

Genscript
show all products

Specifications

Host species

Mouse

Immunogen

Purified recombinant yeast SUMO protein

(DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG             IRIQADQAPEDLDMEDNDIIEAHREQIGG)

Conjugate

Unconjugated

Form

Lyophilized

Storage buffer

Lyophilized with PBS, pH 7.4, containing 0.02% sodium azide

Reconstitution

Reconstitute the lyophilized powder with deionized water (or equivalent) to a final concentration of 0.5 mg/mL

Storage

The antibody is stable in lyophilized form if stored at -20°C or below. The reconstituted antibody can be stored for 2-3 weeks at 2-8°C. For long term storage, aliquot and store at -20°C or below. Avoid repeated freezing and thawing cycles.

Purification

Protein A affinity column

Isotype

Mouse IgG2a,κ

Clonality

Monoclonal

Clone ID

4G11E9

Related products

If you continue we assume that you consent to receive all cookies on this website. More information

My Cart